PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00155110001
Common NameGSBRNA2T00155110001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family LBD
Protein Properties Length: 228aa    MW: 24954.3 Da    PI: 8.3793
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00155110001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260132.61.5e-41461451100
               DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleql 90 
                          +CaaCk+lrr+Ca++C+++pyf  ++p+kfa vhk+FGasnv+k+l ++pe++r da++slvyeA++r+rdPvyG++g i++lq+q++ l
  GSBRNA2T00155110001  46 PCAACKLLRRRCAQECPFSPYFSPHEPHKFASVHKVFGASNVSKMLMEVPENQRADAANSLVYEANVRLRDPVYGCMGAISALQHQVQAL 135
                          7***************************************************************************************** PP

               DUF260  91 kaelallkee 100
                          +ael ++++e
  GSBRNA2T00155110001 136 QAELTAVRSE 145
                          *****99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.81345146IPR004883Lateral organ boundaries, LOB
PfamPF031954.2E-4246143IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 228 aa     Download sequence    Send to blast
MSRERERFEE IGKKIKREAD AWPHQMAGII RRPMSGPHGT LNTITPCAAC KLLRRRCAQE  60
CPFSPYFSPH EPHKFASVHK VFGASNVSKM LMEVPENQRA DAANSLVYEA NVRLRDPVYG  120
CMGAISALQH QVQALQAELT AVRSEILKYN QREAVATLIV PSNPQVAGFH NSGGVSVIAP  180
QPQTPSTPPQ PTAAHPPPPP SSCVFSQPTT RPLEYGDIES ENNSYFG*
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00155110001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB4738440.0AB473844.1 Arabidopsis thaliana ASL11 mRNA for ASYMMETRIC LEAVES2-like 11 protein, complete cds.
GenBankBT0252880.0BT025288.1 Arabidopsis thaliana At2g40470 mRNA, complete cds.
GenBankDQ4466130.0DQ446613.1 Arabidopsis thaliana clone pENTR221-At2g40470 LOB domain protein 15/lateral organ boundaries domain protein 15 (At2g40470) mRNA, complete cds.
GenBankDQ6530510.0DQ653051.1 Arabidopsis thaliana clone 0000012791_0000009246 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013636312.11e-170PREDICTED: LOB domain-containing protein 15
SwissprotQ8L5T51e-130LBD15_ARATH; LOB domain-containing protein 15
TrEMBLA0A078E0T71e-169A0A078E0T7_BRANA; BnaC04g47180D protein
TrEMBLA0A0D3C5F61e-169A0A0D3C5F6_BRAOL; Uncharacterized protein
STRINGAT2G40470.11e-128(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM19272781
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40470.11e-129LOB domain-containing protein 15
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]